PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01371.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 182aa    MW: 21260.2 Da    PI: 8.6791
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01371.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.99.5e-27959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien +nrqvtfskRr+gi KKA E+ vLCda+v ++ifss gkly+y++
  Zmw_sc01371.1.g00020.1.sm.mk  9 KRIENATNRQVTFSKRRAGIVKKAREIGVLCDADVGIVIFSSAGKLYDYCT 59
                                  79***********************************************96 PP

2K-box23.52.2e-0971107137
                         K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRh 37 
                                   yq++sgk l+++k++sl+ e++++kke++n+q e+R 
  Zmw_sc01371.1.g00020.1.sm.mk  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRL 107
                                   89999999*************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.721161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-32295IPR002100Transcription factor, MADS-box
CDDcd002654.54E-41280No hitNo description
PRINTSPR004042.4E-28323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT FSKRRAGIVK KAREIGVLCD ADVGIVIFSS AGKLYDYCTP  60
RTTLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRLMDY WRLHKRTGKI  120
LEDEHRVLTL RAEVELSGGM KDLDIGFQYH QVHHDRDFSS QMPFTFRVQP SHPNLQDEED  180
EQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-18186178Myocyte-specific enhancer factor 2B
1tqe_R1e-18186178Myocyte-specific enhancer factor 2B
1tqe_Q1e-18186178Myocyte-specific enhancer factor 2B
1tqe_P1e-18186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962034.11e-104PREDICTED: MADS-box transcription factor 4-like
SwissprotQ407032e-98MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA0A127J9I81e-106A0A127J9I8_9POAL; PISTILLATA-like MADS-box transcription factor PI-1
STRINGSi023214m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877